Accession Number: pdtdbt00001

Details of the Target and Disease

Target Name : Dengue 2 Virus Envelope Protein
Target Keywords : Dengue 2 Virus Envelope Protein, DENV-2, Dengue fever
Target Description :
Dengue virus is a positive–stranded RNA virus. The 11 kb RNA genome encodes for a single polyprotein. This polyprotein is then cleaved in the cytoplasm into three structural and seven non-structural proteins. The structural proteins includes Capsid (C) protein, Membrane (M) protein and Envelope (E) protein. These protein plays an important role in the viral particle formations. The non-structural proteins (NS1, NS2a, NS2b, NS3, NS4a, NS4b, and NS5) are involved in the replication, assembly and immune response escape.

Target Sequence :
>1OKE:A/B|PDBID|CHAIN|SEQUENCE MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKIVQPENLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK

Disease Name : Dengue fever
Disease Description :
Dengue fever is transmitted by the bite of an Aedes aegypti mosquito infected with a dengue virus. The mosquito becomes infected when it bites a person with dengue virus in their blood. It can’t be spread directly from one person to another person.
Disease Symptoms :

Symptoms, which usually begin four to six days after infection and last for up to 10 days, may include

  • Sudden, high fever
  • Severe headaches
  • Pain behind the eyes
  • Severe joint and muscle pain
  • Fatigue
  • Nausea
  • Vomiting
  • Skin rash, which appears two to five days after the onset of fever
  • Mild bleeding (such a nose bleed, bleeding gums, or easy bruising)
Target Related Dockings :
Target References :
  1. http://dx.doi.org/10.2210/pdb1oke/pdb
  2. http://scholarsresearchlibrary.com/JCMMD-vol5-iss2/JCMMD-2015-5-2-1-7.pdf
Disease References :
  1. http://www.webmd.com/a-to-z-guides/dengue-fever-reference
Dengue 2 Virus Envelope Protein

Click the image to enlarge


Dengue fever

Click the image to enlarge