Accession Number: pdtdbt00005

Details of the Target and Disease

Target Name : PDZ domain-containing protein GIPC2
Target Keywords : PDZ domain, GIPC2, PDZ domain protein GIPC2, Staphylococcus aureus
Target Description :
GIPC PDZ domain containing family, member 2 (GIPC2) is a protein that, in humans, is encoded by the GIPC2 gene. An important paralog of this gene is GIPC3.

Target Sequence :
>3GGE:A/B/C|PDBID|CHAIN|SEQUENCE SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA

Disease Name : Staphylococcus aureus
Disease Description :
Staphylococcus aureus is a gram-positive coccal bacterium that is a member of the Firmicutes, and is frequently found in the nose, respiratory tract, and on the skin. It is often positive for catalase and nitrate reduction. Although S. aureus is not always pathogenic, it is a common cause of skin infections such as abscesses, respiratory infections such as sinusitis, and food poisoning. Pathogenic strains often promote infections by producing potent protein toxins, and expressing cell-surface proteins that bind and inactivate antibodies. The emergence of antibiotic-resistant strains of S. aureus such as MRSA is a worldwide problem in clinical medicine.
Disease Symptoms :
Staphylococcus aureus can cause a range of illnesses, from minor skin infections, such as pimples, impetigo, boils, cellulitis, folliculitis, carbuncles, scalded skin syndrome, and abscesses, to life-threatening diseases such as pneumonia, meningitis, osteomyelitis, endocarditis, toxic shock syndrome, bacteremia, and sepsis. It is still one of the five most common causes of hospital-acquired infections and is often the cause of postsurgical wound infections.
Target Related Dockings :
Target References :
  1. http://dx.doi.org/10.2210/pdb3gge/pdb
  2. https://en.wikipedia.org/wiki/GIPC2
Disease References :
  1. https://en.wikipedia.org/wiki/Staphylococcus_aureus
PDZ domain-containing protein GIPC2

Click the image to enlarge


Staphylococcus aureus

Click the image to enlarge